Lineage for d1auva1 (1auv A:112-213)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470351Family c.30.1.5: Synapsin domain [52463] (2 proteins)
    automatically mapped to Pfam PF02078
  6. 2470352Protein Synapsin I [52464] (2 species)
  7. 2470353Species Cow (Bos taurus) [TaxId:9913] [52465] (2 PDB entries)
  8. 2470354Domain d1auva1: 1auv A:112-213 [31723]
    Other proteins in same PDB: d1auva2, d1auvb2

Details for d1auva1

PDB Entry: 1auv (more details), 2.15 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain
PDB Compounds: (A:) synapsin ia

SCOPe Domain Sequences for d1auva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auva1 c.30.1.5 (A:112-213) Synapsin I {Cow (Bos taurus) [TaxId: 9913]}
aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsi

SCOPe Domain Coordinates for d1auva1:

Click to download the PDB-style file with coordinates for d1auva1.
(The format of our PDB-style files is described here.)

Timeline for d1auva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1auva2