Lineage for d5dzmc_ (5dzm C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2886080Protein automated matches [190266] (7 species)
    not a true protein
  7. 2886094Species Human immunodeficiency virus 1, escherichia coli [TaxId:11676] [189090] (3 PDB entries)
  8. 2886097Domain d5dzmc_: 5dzm C: [317220]
    automated match to d3k2pa_

Details for d5dzmc_

PDB Entry: 5dzm (more details), 2.05 Å

PDB Description: hiv-1 reverse transcriptase rh domain
PDB Compounds: (C:) Ribonuclease H

SCOPe Domain Sequences for d5dzmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dzmc_ c.55.3.1 (C:) automated matches {Human immunodeficiency virus 1, escherichia coli [TaxId: 11676]}
mnelyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp

SCOPe Domain Coordinates for d5dzmc_:

Click to download the PDB-style file with coordinates for d5dzmc_.
(The format of our PDB-style files is described here.)

Timeline for d5dzmc_: