SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hgsa1 (2hgs A:202-303)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107013Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein)
    circularly permuted version of prokaryotic enzyme
    automatically mapped to Pfam PF03199
  6. 2107014Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species)
  7. 2107020Species Human (Homo sapiens) [TaxId:9606] [52462] (1 PDB entry)
  8. 2107021Domain d2hgsa1: 2hgs A:202-303 [31722]
    Other proteins in same PDB: d2hgsa4
    complexed with adp, gsh, mg, so4

Details for d2hgsa1

PDB Entry: 2hgs (more details), 2.1 Å

PDB Description: human glutathione synthetase
PDB Compounds: (A:) protein (glutathione synthetase)

SCOPe Domain Sequences for d2hgsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgsa1 c.30.1.4 (A:202-303) Eukaryotic glutathione synthetase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]}
pnalvlliaqekernifdqraienellarnihvirrtfedisekgsldqdrrlfvdgqei
avvyfrdgymprqyslqnwearlllershaakcpdiatqlag

SCOPe Domain Coordinates for d2hgsa1:

Click to download the PDB-style file with coordinates for d2hgsa1.
(The format of our PDB-style files is described here.)

Timeline for d2hgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hgsa4