| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries) |
| Domain d5dd5l2: 5dd5 L:107-213 [317213] Other proteins in same PDB: d5dd5h2 automated match to d4oawa2 |
PDB Entry: 5dd5 (more details), 1.9 Å
SCOPe Domain Sequences for d5dd5l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dd5l2 b.1.1.0 (L:107-213) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
kravaapsvfifppsedqvksgtvsvvcllnnfypreasvkwkvdgvlktgnsqesvteq
dskdntyslsstltlsntdyqshnvyacevthqglsspvtksfnrge
Timeline for d5dd5l2: