![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
![]() | Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) ![]() |
![]() | Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein) |
![]() | Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52459] (4 PDB entries) |
![]() | Domain d1glv_1: 1glv 1-122 [31721] Other proteins in same PDB: d1glv_2 |
PDB Entry: 1glv (more details), 2.7 Å
SCOP Domain Sequences for d1glv_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glv_1 c.30.1.3 (1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli} miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr dc
Timeline for d1glv_1: