SCOP 1.57: Domain d1glv_1: 1glv 1-122

Lineage for d1glv_1 (1glv 1-122)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein)

6. Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species)

7. Species Escherichia coli [TaxId:562] [52459] (4 PDB entries)

8. Domain d1glv_1: 1glv 1-122 [31721]
   Other proteins in same PDB: d1glv_2

Details for d1glv_1

PDB Entry: 1glv, 2.7 Å

PDB Description: three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution

SCOP Domain Sequences for d1glv_1:

Sequence; same for both SEQRES and ATOM records:

>d1glv_1 c.30.1.3 (1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli}
miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk
qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr
dc

Timeline for d1glv_1:

• d1glv_1 first appeared (with stable ids) in SCOP 1.55
  
• d1glv_1 appears in SCOP 1.59
  
• d1glv_1 appears in the current release, SCOPe 2.08, called d1glva1