Lineage for d1glv_1 (1glv 1-122)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) 
Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein) Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species) Species Escherichia coli [TaxId:562] [52459] (4 PDB entries) 
Domain d1glv_1: 1glv 1-122 [31721]
Other proteins in same PDB: d1glv_2
Details for d1glv_1
PDB Entry: 1glv (more details), 2.7 Å
PDB Description: three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution
SCOP Domain Sequences for d1glv_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glv_1 c.30.1.3 (1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli}
miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk
qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr
dc
SCOP Domain Coordinates for d1glv_1:
Click to download the PDB-style file with coordinates for d1glv_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1glv_1:
- d1glv_1 appears in SCOP 1.57
- d1glv_1 appears in the current release, SCOPe 2.08, called d1glva1
View in 3D
