SCOPe 2.08: Domain d5a0yd1: 5a0y D:2-269

Lineage for d5a0yd1 (5a0y D:2-269)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein automated matches [315351] (3 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:145263] [315352] (2 PDB entries)

8. Domain d5a0yd1: 5a0y D:2-269 [317206]
   Other proteins in same PDB: d5a0ya2, d5a0yb2, d5a0yc_, d5a0yd2, d5a0ye2, d5a0yf_
   automated match to d1hbna2
   complexed with cl, com, f43, k, mg, na, tp7

Details for d5a0yd1

PDB Entry: 5a0y, 1.1 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter marburgensis at 1.1 a resolution

PDB Compounds: (D:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d5a0yd1:

Sequence; same for both SEQRES and ATOM records:

>d5a0yd1 d.58.31.2 (D:2-269) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

Timeline for d5a0yd1:

• d5a0yd1 first appeared in SCOPe 2.06
  
• d5a0yd1 appears in SCOPe 2.07