SCOP 1.55: Domain d2glt_1: 2glt 1-122

Lineage for d2glt_1 (2glt 1-122)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein)

6. Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species)

7. Species Escherichia coli [TaxId:562] [52459] (4 PDB entries)

8. Domain d2glt_1: 2glt 1-122 [31720]
   Other proteins in same PDB: d2glt_2

Details for d2glt_1

PDB Entry: 2glt, 2.2 Å

PDB Description: structure of escherichia coli glutathione synthetase at ph 6.0.

SCOP Domain Sequences for d2glt_1:

Sequence; same for both SEQRES and ATOM records:

>d2glt_1 c.30.1.3 (1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli}
miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk
qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr
dc

Timeline for d2glt_1:

• d2glt_1 appears in SCOP 1.57
  
• d2glt_1 appears in the current release, SCOPe 2.08, called d2glta1