Lineage for d5ccta_ (5cct A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2407003Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2407004Protein automated matches [191182] (17 species)
    not a true protein
  7. 2407204Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries)
  8. 2407209Domain d5ccta_: 5cct A: [317194]
    automated match to d3zeza_
    complexed with dup, mg; mutant

Details for d5ccta_

PDB Entry: 5cct (more details), 2.4 Å

PDB Description: staphylococcus bacteriophage 80alpha dutpase g164s mutant with dupnhpp.
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d5ccta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ccta_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagyhgnlginikndheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefesvsergeksfgssgv

SCOPe Domain Coordinates for d5ccta_:

Click to download the PDB-style file with coordinates for d5ccta_.
(The format of our PDB-style files is described here.)

Timeline for d5ccta_: