Lineage for d5ab1a_ (5ab1 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377427Protein automated matches [190569] (9 species)
    not a true protein
  7. 2377444Species Escherichia coli [TaxId:562] [188033] (7 PDB entries)
  8. 2377451Domain d5ab1a_: 5ab1 A: [317184]
    automated match to d3zl2a_
    complexed with bcd, hp6, man, ta5

Details for d5ab1a_

PDB Entry: 5ab1 (more details), 1.96 Å

PDB Description: complex of the fimh lectin with a beta-cyclodextrin c-linked alpha-d- mannoside in cocrystallized orthorhombic crystals at 2.00 a resolution
PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d5ab1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ab1a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptg

SCOPe Domain Coordinates for d5ab1a_:

Click to download the PDB-style file with coordinates for d5ab1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ab1a_: