Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
Protein automated matches [190569] (9 species) not a true protein |
Species Escherichia coli [TaxId:562] [188033] (7 PDB entries) |
Domain d5ab1a_: 5ab1 A: [317184] automated match to d3zl2a_ complexed with bcd, hp6, man, ta5 |
PDB Entry: 5ab1 (more details), 1.96 Å
SCOPe Domain Sequences for d5ab1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ab1a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvptg
Timeline for d5ab1a_: