Lineage for d1gsaa1 (1gsa A:1-122)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862071Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein)
    automatically mapped to Pfam PF02951
  6. 2862072Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species)
  7. 2862073Species Escherichia coli [TaxId:562] [52459] (4 PDB entries)
  8. 2862074Domain d1gsaa1: 1gsa A:1-122 [31718]
    Other proteins in same PDB: d1gsaa2
    complexed with adp, gsh, mg, so4

Details for d1gsaa1

PDB Entry: 1gsa (more details), 2 Å

PDB Description: structure of glutathione synthetase complexed with adp and glutathione
PDB Compounds: (A:) glutathione synthetase

SCOPe Domain Sequences for d1gsaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsaa1 c.30.1.3 (A:1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk
qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr
dc

SCOPe Domain Coordinates for d1gsaa1:

Click to download the PDB-style file with coordinates for d1gsaa1.
(The format of our PDB-style files is described here.)

Timeline for d1gsaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsaa2