SCOPe 2.08: Domain d1gsaa1: 1gsa A:1-122

Lineage for d1gsaa1 (1gsa A:1-122)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.3: Prokaryotic glutathione synthetase, N-terminal domain [52457] (1 protein)
   automatically mapped to Pfam PF02951

6. Protein Prokaryotic glutathione synthetase, N-terminal domain [52458] (1 species)

7. Species Escherichia coli [TaxId:562] [52459] (4 PDB entries)

8. Domain d1gsaa1: 1gsa A:1-122 [31718]
   Other proteins in same PDB: d1gsaa2
   complexed with adp, gsh, mg, so4

Details for d1gsaa1

PDB Entry: 1gsa, 2 Å

PDB Description: structure of glutathione synthetase complexed with adp and glutathione

PDB Compounds: (A:) glutathione synthetase

SCOPe Domain Sequences for d1gsaa1:

Sequence; same for both SEQRES and ATOM records:

>d1gsaa1 c.30.1.3 (A:1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
miklgivmdpianinikkdssfamlleaqrrgyelhymemgdlylingearahtrtlnvk
qnyeewfsfvgeqdlpladldvilmrkdppfdtefiyatyileraeekgtlivnkpqslr
dc

Timeline for d1gsaa1:

• d1gsaa1 first appeared (with stable ids) in SCOP 1.55, called d1gsa_1
  
• d1gsaa1 appears in SCOPe 2.07