| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
| Family a.118.3.1: Sec7 domain [48426] (6 proteins) Pfam PF01369 |
| Protein automated matches [194433] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [194434] (2 PDB entries) |
| Domain d4z21a_: 4z21 A: [317164] automated match to d1r8me_ complexed with edo |
PDB Entry: 4z21 (more details), 2.05 Å
SCOPe Domain Sequences for d4z21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z21a_ a.118.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
rnlydsirnepfkipe
Timeline for d4z21a_: