Lineage for d1ehia1 (1ehi A:3-134)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862050Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 2862064Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species)
  7. 2862068Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [52456] (1 PDB entry)
  8. 2862069Domain d1ehia1: 1ehi A:3-134 [31716]
    Other proteins in same PDB: d1ehia2, d1ehib2
    complexed with adp, mg, phy

Details for d1ehia1

PDB Entry: 1ehi (more details), 2.38 Å

PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
PDB Compounds: (A:) d-alanine:d-lactate ligase

SCOPe Domain Sequences for d1ehia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
kkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkilal
edeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldkpy
vgaplrghavsf

SCOPe Domain Coordinates for d1ehia1:

Click to download the PDB-style file with coordinates for d1ehia1.
(The format of our PDB-style files is described here.)

Timeline for d1ehia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehia2