SCOPe 2.08: Domain d1ehia1: 1ehi A:3-134

Lineage for d1ehia1 (1ehi A:3-134)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)

6. Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species)

7. Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [52456] (1 PDB entry)

8. Domain d1ehia1: 1ehi A:3-134 [31716]
   Other proteins in same PDB: d1ehia2, d1ehib2
   complexed with adp, mg, phy

Details for d1ehia1

PDB Entry: 1ehi, 2.38 Å

PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides

PDB Compounds: (A:) d-alanine:d-lactate ligase

SCOPe Domain Sequences for d1ehia1:

Sequence; same for both SEQRES and ATOM records:

>d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
kkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkilal
edeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldkpy
vgaplrghavsf

Timeline for d1ehia1:

• d1ehia1 first appeared (with stable ids) in SCOP 1.55
  
• d1ehia1 appears in SCOPe 2.07