| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins) |
| Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species) |
| Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [52456] (1 PDB entry) |
| Domain d1ehia1: 1ehi A:3-134 [31716] Other proteins in same PDB: d1ehia2, d1ehib2 complexed with adp, mg, phy |
PDB Entry: 1ehi (more details), 2.38 Å
SCOPe Domain Sequences for d1ehia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
kkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkilal
edeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldkpy
vgaplrghavsf
Timeline for d1ehia1: