SCOPe 2.07: Domain d5dw6a1: 5dw6 A:3-229

Lineage for d5dw6a1 (5dw6 A:3-229)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (16 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)

8. Domain d5dw6a1: 5dw6 A:3-229 [317156]
   Other proteins in same PDB: d5dw6a3
   automated match to d4eu3a1
   complexed with 0t1, act, imd

Details for d5dw6a1

PDB Entry: 5dw6, 1.55 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) bound to acetate and the coa analogue 3'-phosphoadenosine 5'-(o-(n-propyl-r-pantothenamide)) pyrophosphate (mx)

PDB Compounds: (A:) Succinyl-CoA:acetate CoA-transferase

SCOPe Domain Sequences for d5dw6a1:

Sequence; same for both SEQRES and ATOM records:

>d5dw6a1 c.124.1.0 (A:3-229) automated matches {Acetobacter aceti [TaxId: 435]}
erirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgeky
qislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagrav
qgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihdi
wdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrn

Timeline for d5dw6a1:

• d5dw6a1 first appeared in SCOPe 2.06
  
• d5dw6a1 appears in the current release, SCOPe 2.08