Lineage for d4zt7b1 (4zt7 B:-1-606)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443452Species Trypanosoma brucei [TaxId:999953] [226467] (27 PDB entries)
  8. 2443474Domain d4zt7b1: 4zt7 B:-1-606 [317151]
    Other proteins in same PDB: d4zt7a2, d4zt7b2, d4zt7b3
    automated match to d4eg8b1
    protein/RNA complex; complexed with 4rc, dms, gol, met

Details for d4zt7b1

PDB Entry: 4zt7 (more details), 2.4 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor n-[(4r)-6,8-dichloro-1,2,3,4-tetrahydroquinolin-4-yl]-n'-(5-fluoro- 3h-imidazo[4,5-b]pyridin-2-yl)propane-1,3-diamine (chem 1717)
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4zt7b1:

Sequence, based on SEQRES records: (download)

>d4zt7b1 c.26.1.0 (B:-1-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
smkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkva
eaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdi
ylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafre
rllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvw
ldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsa
glplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdys
dknmiarlngel

Sequence, based on observed residues (ATOM records): (download)

>d4zt7b1 c.26.1.0 (B:-1-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
smkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkva
eaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdi
ylgryegwysisdesfltpqnitdgckvslesghvvtwvseenymfrlsafrerllewyh
anpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltny
ltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkk
ivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiar
lngel

SCOPe Domain Coordinates for d4zt7b1:

Click to download the PDB-style file with coordinates for d4zt7b1.
(The format of our PDB-style files is described here.)

Timeline for d4zt7b1: