Lineage for d2dln_1 (2dln 1-96)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22644Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 22645Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 22729Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 22730Protein D-Ala-D-Ala ligase [52453] (1 species)
  7. 22731Species Escherichia coli, gene ddlB [TaxId:562] [52454] (3 PDB entries)
  8. 22734Domain d2dln_1: 2dln 1-96 [31715]
    Other proteins in same PDB: d2dln_2

Details for d2dln_1

PDB Entry: 2dln (more details), 2.3 Å

PDB Description: vancomycin resistance: structure of d-alanine:d-alanine ligase at 2.3 angstroms resolution

SCOP Domain Sequences for d2dln_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dln_1 c.30.1.2 (1-96) D-Ala-D-Ala ligase {Escherichia coli, gene ddlB}
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmd

SCOP Domain Coordinates for d2dln_1:

Click to download the PDB-style file with coordinates for d2dln_1.
(The format of our PDB-style files is described here.)

Timeline for d2dln_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dln_2