Lineage for d4zs7l2 (4zs7 L:112-212)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030575Species Lama glama [TaxId:9844] [317148] (1 PDB entry)
  8. 2030576Domain d4zs7l2: 4zs7 L:112-212 [317149]
    Other proteins in same PDB: d4zs7a_, d4zs7l1
    automated match to d1aqkl2

Details for d4zs7l2

PDB Entry: 4zs7 (more details), 2.93 Å

PDB Description: structural mimicry of receptor interaction by antagonistic il-6 antibodies
PDB Compounds: (L:) Llama Fab fragment 68F2 light chain

SCOPe Domain Sequences for d4zs7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zs7l2 b.1.1.2 (L:112-212) automated matches {Lama glama [TaxId: 9844]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4zs7l2:

Click to download the PDB-style file with coordinates for d4zs7l2.
(The format of our PDB-style files is described here.)

Timeline for d4zs7l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zs7l1
View in 3D
Domains from other chains:
(mouse over for more information)
d4zs7a_