SCOPe 2.06: Domain d4zs7l1: 4zs7 L:3-111

Lineage for d4zs7l1 (4zs7 L:3-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (9 PDB entries)

8. Domain d4zs7l1: 4zs7 L:3-111 [317147]
   Other proteins in same PDB: d4zs7a_, d4zs7l2
   automated match to d1aqkl1

Details for d4zs7l1

PDB Entry: 4zs7, 2.93 Å

PDB Description: structural mimicry of receptor interaction by antagonistic il-6 antibodies

PDB Compounds: (L:) Llama Fab fragment 68F2 light chain

SCOPe Domain Sequences for d4zs7l1:

Sequence; same for both SEQRES and ATOM records:

>d4zs7l1 b.1.1.0 (L:3-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
vltqpplvsgtpgqtvtiscaganndigtyayvswyqqlpgtapklliykvttrasgips
rfsgsksgntasltisglqsedeadyycasyrnfnnavfgrgthltvlg

Timeline for d4zs7l1:

• d4zs7l1 is new in SCOPe 2.06-stable
  
• d4zs7l1 appears in SCOPe 2.07
  
• d4zs7l1 appears in the current release, SCOPe 2.08