Lineage for d5jd3e1 (5jd3 E:1-217)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857572Species Uncultured bacterium [TaxId:77133] [317019] (1 PDB entry)
  8. 2857577Domain d5jd3e1: 5jd3 E:1-217 [317133]
    Other proteins in same PDB: d5jd3a2, d5jd3b2, d5jd3c2, d5jd3d2, d5jd3e2, d5jd3f2, d5jd3g2, d5jd3h2
    automated match to d4jhla_
    complexed with cl, peg, so4

Details for d5jd3e1

PDB Entry: 5jd3 (more details), 2.3 Å

PDB Description: crystal structure of lae5, an alpha/beta hydrolase enzyme from the metagenome of lake arreo, spain
PDB Compounds: (E:) lae5

SCOPe Domain Sequences for d5jd3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jd3e1 c.23.10.0 (E:1-217) automated matches {Uncultured bacterium [TaxId: 77133]}
myfaagsklviigdsitdagrdkgiggeglfnahgsgyvallnahlfarfperrlrlvnq
gnsgntvrdlaarwqndvfglkpdyvammigindvwrqfdlplmtdrhvcpeeyektlde
lvartaptvkgmilltpyfiepnredamrarmdvygdlmrrvaerhgcllvdvqgafdry
lqhyhpaqlawdrihpnlaghqvianaflaatgclns

SCOPe Domain Coordinates for d5jd3e1:

Click to download the PDB-style file with coordinates for d5jd3e1.
(The format of our PDB-style files is described here.)

Timeline for d5jd3e1: