Lineage for d5j6bd_ (5j6b D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2516588Species Burkholderia thailandensis [TaxId:271848] [256344] (2 PDB entries)
  8. 2516594Domain d5j6bd_: 5j6b D: [317130]
    Other proteins in same PDB: d5j6ba2
    automated match to d2impa_
    complexed with cl, ndp

Details for d5j6bd_

PDB Entry: 5j6b (more details), 1.95 Å

PDB Description: crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with nadph
PDB Compounds: (D:) aldehyde dehydrogenase

SCOPe Domain Sequences for d5j6bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6bd_ c.82.1.0 (D:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavgaqkplral
pafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrvaaeesvrie
gglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpas
rtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgsptvgwelkkk
agkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqriiahadvyda
lrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakivaggkvdgam
featllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvftdslshaq
rawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlmvvrrr

SCOPe Domain Coordinates for d5j6bd_:

Click to download the PDB-style file with coordinates for d5j6bd_.
(The format of our PDB-style files is described here.)

Timeline for d5j6bd_: