SCOP 1.57: Domain d1iow_1: 1iow 1-96

Lineage for d1iow_1 (1iow 1-96)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)

6. Protein D-Ala-D-Ala ligase [52453] (1 species)

7. Species Escherichia coli, gene ddlB [TaxId:562] [52454] (3 PDB entries)

8. Domain d1iow_1: 1iow 1-96 [31713]
   Other proteins in same PDB: d1iow_2

Details for d1iow_1

PDB Entry: 1iow, 1.9 Å

PDB Description: complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate

SCOP Domain Sequences for d1iow_1:

Sequence; same for both SEQRES and ATOM records:

>d1iow_1 c.30.1.2 (1-96) D-Ala-D-Ala ligase {Escherichia coli, gene ddlB}
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmd

Timeline for d1iow_1:

• d1iow_1 first appeared (with stable ids) in SCOP 1.55
  
• d1iow_1 appears in SCOP 1.59
  
• d1iow_1 appears in the current release, SCOPe 2.08, called d1iowa1