Lineage for d1iow_1 (1iow 1-96)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22644Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 22645Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 22729Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 22730Protein D-Ala-D-Ala ligase [52453] (1 species)
  7. 22731Species Escherichia coli, gene ddlB [TaxId:562] [52454] (3 PDB entries)
  8. 22732Domain d1iow_1: 1iow 1-96 [31713]
    Other proteins in same PDB: d1iow_2

Details for d1iow_1

PDB Entry: 1iow (more details), 1.9 Å

PDB Description: complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate

SCOP Domain Sequences for d1iow_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iow_1 c.30.1.2 (1-96) D-Ala-D-Ala ligase {Escherichia coli, gene ddlB}
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmd

SCOP Domain Coordinates for d1iow_1:

Click to download the PDB-style file with coordinates for d1iow_1.
(The format of our PDB-style files is described here.)

Timeline for d1iow_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iow_2