Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) |
Family b.34.3.0: automated matches [227148] (1 protein) not a true family |
Protein automated matches [226852] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [317125] (1 PDB entry) |
Domain d4zlka1: 4zlk A:4-62 [317126] Other proteins in same PDB: d4zlka2, d4zlkb_ automated match to d1oe9a1 complexed with ca |
PDB Entry: 4zlk (more details), 2.5 Å
SCOPe Domain Sequences for d4zlka1:
Sequence, based on SEQRES records: (download)
>d4zlka1 b.34.3.0 (A:4-62) automated matches {Mouse (Mus musculus) [TaxId: 10090]} selytkfarvwipdpeevwksaellkdykpgdkvlllhleegkdleyrldpktgelphl
>d4zlka1 b.34.3.0 (A:4-62) automated matches {Mouse (Mus musculus) [TaxId: 10090]} selytkfarvwipdpeevwksaellkdykpgdkvlllhlekdleyrlgelphl
Timeline for d4zlka1: