SCOPe 2.06: Domain d4zlka1: 4zlk A:4-62

Lineage for d4zlka1 (4zlk A:4-62)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.0: automated matches [227148] (1 protein)
   not a true family

6. Protein automated matches [226852] (4 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [317125] (1 PDB entry)

8. Domain d4zlka1: 4zlk A:4-62 [317126]
   Other proteins in same PDB: d4zlka2, d4zlkb_
   automated match to d1oe9a1
   complexed with ca

Details for d4zlka1

PDB Entry: 4zlk, 2.5 Å

PDB Description: crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin

PDB Compounds: (A:) Unconventional myosin-Va

SCOPe Domain Sequences for d4zlka1:

Sequence, based on SEQRES records:

>d4zlka1 b.34.3.0 (A:4-62) automated matches {Mus musculus [TaxId: 10090]}
selytkfarvwipdpeevwksaellkdykpgdkvlllhleegkdleyrldpktgelphl

Sequence, based on observed residues (ATOM records):

>d4zlka1 b.34.3.0 (A:4-62) automated matches {Mus musculus [TaxId: 10090]}
selytkfarvwipdpeevwksaellkdykpgdkvlllhlekdleyrlgelphl

Timeline for d4zlka1:

• d4zlka1 is new in SCOPe 2.06-stable
  
• d4zlka1 appears in SCOPe 2.07
  
• d4zlka1 appears in the current release, SCOPe 2.08