Lineage for d4zlka1 (4zlk A:4-62)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783669Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2783726Family b.34.3.0: automated matches [227148] (1 protein)
    not a true family
  6. 2783727Protein automated matches [226852] (4 species)
    not a true protein
  7. 2783737Species Mouse (Mus musculus) [TaxId:10090] [317125] (1 PDB entry)
  8. 2783738Domain d4zlka1: 4zlk A:4-62 [317126]
    Other proteins in same PDB: d4zlka2, d4zlkb_
    automated match to d1oe9a1
    complexed with ca

Details for d4zlka1

PDB Entry: 4zlk (more details), 2.5 Å

PDB Description: crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
PDB Compounds: (A:) Unconventional myosin-Va

SCOPe Domain Sequences for d4zlka1:

Sequence, based on SEQRES records: (download)

>d4zlka1 b.34.3.0 (A:4-62) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
selytkfarvwipdpeevwksaellkdykpgdkvlllhleegkdleyrldpktgelphl

Sequence, based on observed residues (ATOM records): (download)

>d4zlka1 b.34.3.0 (A:4-62) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
selytkfarvwipdpeevwksaellkdykpgdkvlllhlekdleyrlgelphl

SCOPe Domain Coordinates for d4zlka1:

Click to download the PDB-style file with coordinates for d4zlka1.
(The format of our PDB-style files is described here.)

Timeline for d4zlka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zlka2
View in 3D
Domains from other chains:
(mouse over for more information)
d4zlkb_