SCOPe 2.08: Domain d5jd3g1: 5jd3 G:2-217

Lineage for d5jd3g1 (5jd3 G:2-217)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (16 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [317019] (1 PDB entry)

8. Domain d5jd3g1: 5jd3 G:2-217 [317124]
   Other proteins in same PDB: d5jd3a2, d5jd3b2, d5jd3c2, d5jd3d2, d5jd3e2, d5jd3f2, d5jd3g2, d5jd3h2
   automated match to d4jhla_
   complexed with cl, peg, so4

Details for d5jd3g1

PDB Entry: 5jd3, 2.3 Å

PDB Description: crystal structure of lae5, an alpha/beta hydrolase enzyme from the metagenome of lake arreo, spain

PDB Compounds: (G:) lae5

SCOPe Domain Sequences for d5jd3g1:

Sequence; same for both SEQRES and ATOM records:

>d5jd3g1 c.23.10.0 (G:2-217) automated matches {Uncultured bacterium [TaxId: 77133]}
yfaagsklviigdsitdagrdkgiggeglfnahgsgyvallnahlfarfperrlrlvnqg
nsgntvrdlaarwqndvfglkpdyvammigindvwrqfdlplmtdrhvcpeeyektldel
vartaptvkgmilltpyfiepnredamrarmdvygdlmrrvaerhgcllvdvqgafdryl
qhyhpaqlawdrihpnlaghqvianaflaatgclns

Timeline for d5jd3g1:

• d5jd3g1 first appeared in SCOPe 2.06, called d5jd3g_
  
• d5jd3g1 was called d5jd3g_ in SCOPe 2.07