Lineage for d4zp3d_ (4zp3 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709186Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2709187Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2709188Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2709206Protein automated matches [190321] (3 species)
    not a true protein
  7. 2709207Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries)
  8. 2709213Domain d4zp3d_: 4zp3 D: [317122]
    automated match to d2hwnb_
    complexed with cd

Details for d4zp3d_

PDB Entry: 4zp3 (more details), 2.63 Å

PDB Description: akap18:pka-riialpha structure reveals crucial anchor points for recognition of regulatory subunits of pka
PDB Compounds: (D:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d4zp3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zp3d_ a.31.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqippgltellqgytvevlrqqppdlvefaveyftrlrear

SCOPe Domain Coordinates for d4zp3d_:

Click to download the PDB-style file with coordinates for d4zp3d_.
(The format of our PDB-style files is described here.)

Timeline for d4zp3d_: