Lineage for d4zs7a_ (4zs7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992771Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1992811Protein Interleukin-6 [47272] (2 species)
  7. 1992812Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)
  8. 1992820Domain d4zs7a_: 4zs7 A: [317121]
    Other proteins in same PDB: d4zs7l1, d4zs7l2
    automated match to d4cnic_

Details for d4zs7a_

PDB Entry: 4zs7 (more details), 2.93 Å

PDB Description: structural mimicry of receptor interaction by antagonistic il-6 antibodies
PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d4zs7a_:

Sequence, based on SEQRES records: (download)

>d4zs7a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
eridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfneet
clvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpt
tnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d4zs7a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
eridkqiryildgisalrketcnksnnlpkmaekdgcfqsgfneetclvkiitgllefev
yleylqnrfesseeqaravqmstkvliqflqkkaknlddpttnaslltklqwlqdmtthl
ilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d4zs7a_:

Click to download the PDB-style file with coordinates for d4zs7a_.
(The format of our PDB-style files is described here.)

Timeline for d4zs7a_: