![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Interleukin-6 [47272] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries) |
![]() | Domain d4zs7a_: 4zs7 A: [317121] Other proteins in same PDB: d4zs7h_, d4zs7l1, d4zs7l2 automated match to d4cnic_ |
PDB Entry: 4zs7 (more details), 2.93 Å
SCOPe Domain Sequences for d4zs7a_:
Sequence, based on SEQRES records: (download)
>d4zs7a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]} eridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfneet clvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpt tnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
>d4zs7a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]} eridkqiryildgisalrketcnksnnlpkmaekdgcfqsgfneetclvkiitgllefev yleylqnrfesseeqaravqmstkvliqflqkkaknlddpttnaslltklqwlqdmtthl ilrsfkeflqsslralrqm
Timeline for d4zs7a_: