| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.1: Papain-like [54002] (26 proteins) |
| Protein (Pro)cathepsin K [54028] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries) Uniprot P43235 116-329 ! Uniprot P43235 115-329 |
| Domain d4yvaa_: 4yva A: [317097] automated match to d1tu6a_ complexed with so4 |
PDB Entry: 4yva (more details), 1.8 Å
SCOPe Domain Sequences for d4yvaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yvaa_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
dsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsendg
cgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekalk
ravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiikn
swgenwgnkgyilmarnknnacgianlasfpkm
Timeline for d4yvaa_: