SCOPe 2.08: Domain d4zdhb2: 4zdh B:115-243

Lineage for d4zdhb2 (4zdh B:115-243)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4zdhb2: 4zdh B:115-243 [317088]
   Other proteins in same PDB: d4zdha1, d4zdha2
   automated match to d4eurb2

Details for d4zdhb2

PDB Entry: 4zdh, 2.1 Å

PDB Description: crystal structure of jka6 tcr

PDB Compounds: (B:) Beta chain of JKF6 T-cell receptor,Protein TRBV28

SCOPe Domain Sequences for d4zdhb2:

Sequence; same for both SEQRES and ATOM records:

>d4zdhb2 b.1.1.0 (B:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevalfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglseadewtqarakpvtqiv
saeawgrad

Timeline for d4zdhb2:

• d4zdhb2 first appeared in SCOPe 2.06
  
• d4zdhb2 appears in SCOPe 2.07