SCOPe 2.08: Domain d5l3db1: 5l3d B:308-375

Lineage for d5l3db1 (5l3d B:308-375)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family)
   Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1

5. Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)

6. Protein Demethylase interaction domain of CoREST [267660] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries)

8. Domain d5l3db1: 5l3d B:308-375 [317085]
   Other proteins in same PDB: d5l3db2
   automated match to d2xafb1
   complexed with fad; mutant

Details for d5l3db1

PDB Entry: 5l3d, 2.6 Å

PDB Description: human lsd1/corest: lsd1 y761h mutation

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d5l3db1:

Sequence; same for both SEQRES and ATOM records:

>d5l3db1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

Timeline for d5l3db1:

• d5l3db1 first appeared in SCOPe 2.06
  
• d5l3db1 appears in SCOPe 2.07