Lineage for d4z8db2 (4z8d B:175-317)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524395Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species)
  7. 2524442Species Escherichia coli [TaxId:83334] [317080] (1 PDB entry)
  8. 2524446Domain d4z8db2: 4z8d B:175-317 [317082]
    automated match to d1hnja2
    complexed with 4lb, so4; mutant

Details for d4z8db2

PDB Entry: 4z8d (more details), 2 Å

PDB Description: antibacterial fabh inhibitors with validated mode of action in haemophilus influenzae by in vitro resistance mutation mapping
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4z8db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z8db2 c.95.1.2 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 83334]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOPe Domain Coordinates for d4z8db2:

Click to download the PDB-style file with coordinates for d4z8db2.
(The format of our PDB-style files is described here.)

Timeline for d4z8db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z8db1