| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins) |
| Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species) duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains |
| Species Escherichia coli [TaxId:562] [52451] (10 PDB entries) |
| Domain d1jdbe4: 1jdb E:556-676 [31708] Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |
PDB Entry: 1jdb (more details), 2.1 Å
SCOP Domain Sequences for d1jdbe4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdbe4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
tdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdrl
yfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedre
r
Timeline for d1jdbe4:
View in 3DDomains from other chains: (mouse over for more information) d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |