Lineage for d4zt6a2 (4zt6 A:607-767)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705974Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2705975Protein automated matches [226872] (13 species)
    not a true protein
  7. 2706020Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries)
  8. 2706033Domain d4zt6a2: 4zt6 A:607-767 [317075]
    Other proteins in same PDB: d4zt6a1, d4zt6b1, d4zt6b3
    automated match to d4eg8b2
    protein/RNA complex; complexed with 4rd, dms, met

Details for d4zt6a2

PDB Entry: 4zt6 (more details), 2.25 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor n-[(4r)-6,8-dichloro-3,4-dihydro-2h-chromen-4-yl]-n'-(5-fluoro-1h- imidazo[4,5-b]pyridin-2-yl)propane-1,3-diamine (chem 1709)
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4zt6a2:

Sequence, based on SEQRES records: (download)

>d4zt6a2 a.27.1.0 (A:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Sequence, based on observed residues (ATOM records): (download)

>d4zt6a2 a.27.1.0 (A:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavevlfskrst

SCOPe Domain Coordinates for d4zt6a2:

Click to download the PDB-style file with coordinates for d4zt6a2.
(The format of our PDB-style files is described here.)

Timeline for d4zt6a2: