Class a: All alpha proteins [46456] (290 folds) |
Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) dimer of identical alpha-hairpin motifs |
Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
Protein automated matches [190321] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187886] (3 PDB entries) |
Domain d4zp3l_: 4zp3 L: [317072] automated match to d2hwnb_ complexed with cd |
PDB Entry: 4zp3 (more details), 2.63 Å
SCOPe Domain Sequences for d4zp3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zp3l_ a.31.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shiqippgltellqgytvevlrqqppdlvefaveyftrlrear
Timeline for d4zp3l_: