SCOPe 2.06: Domain d5jk4a_: 5jk4 A:

Lineage for d5jk4a_ (5jk4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:391008] [317068] (1 PDB entry)

8. Domain d5jk4a_: 5jk4 A: [317069]
   automated match to d2v3qa1
   complexed with po4

Details for d5jk4a_

PDB Entry: 5jk4, 1.1 Å

PDB Description: phosphate-binding protein from stenotrophomonas maltophilia.

PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d5jk4a_:

Sequence; same for both SEQRES and ATOM records:

>d5jk4a_ c.94.1.0 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 391008]}
etavtgggaslpadlykgsadsilpanfsyavtgsgtgkkaflennsalfsttgtvhfag
sdsvlsstelntynstynvsgdanrygalvqipsvatsvtipfnkagsavdlsvtqicgi
fsgkinnwsqlaglgrtgaiqvvyrgessgtselltrfltsacqpadvsgtnlklangvp
afsvqstfanlfttvpsnfvaapatggsalynavyavdgrvgyvgpdvipsltdatkvak
vksfspdevsvqatletaapptgaaaenpanwvpvfgnpsagypiagytnfvfgqcykna
tvganvrgfltrhygstvvngveqgpnddairahkfipltkawrdavrarfatatnagav
nnpstcsgigrpl

Timeline for d5jk4a_:

• d5jk4a_ is new in SCOPe 2.06-stable
  
• d5jk4a_ appears in SCOPe 2.07
  
• d5jk4a_ appears in the current release, SCOPe 2.08