SCOPe 2.08: Domain d4z2aa2: 4z2a A:443-574

Lineage for d4z2aa2 (4z2a A:443-574)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)

8. Domain d4z2aa2: 4z2a A:443-574 [317067]
   Other proteins in same PDB: d4z2aa1
   automated match to d4omca2
   complexed with ca, edo, po4

Details for d4z2aa2

PDB Entry: 4z2a, 1.89 Å

PDB Description: crystal structure of unglycosylated apo human furin @1.89a

PDB Compounds: (A:) Furin

SCOPe Domain Sequences for d4z2aa2:

Sequence; same for both SEQRES and ATOM records:

>d4z2aa2 b.18.1.0 (A:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

Timeline for d4z2aa2:

• d4z2aa2 first appeared in SCOPe 2.06
  
• d4z2aa2 appears in SCOPe 2.07