| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries) Uniprot Q93068 |
| Domain d2n1aa1: 2n1a A:1-101 [317048] Other proteins in same PDB: d2n1aa2, d2n1ab_ automated match to d1a5ra_ complexed with zn |
PDB Entry: 2n1a (more details)
SCOPe Domain Sequences for d2n1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n1aa1 d.15.1.1 (A:1-101) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
Timeline for d2n1aa1: