| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
| Protein automated matches [190492] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries) |
| Domain d5j7ef_: 5j7e F: [317031] automated match to d4hp4b_ |
PDB Entry: 5j7e (more details), 1.9 Å
SCOPe Domain Sequences for d5j7ef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j7ef_ d.110.3.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfvlgnaqivdwpivysndgfcklsgyhraevmqksstcsfmygeltdkdtiekvrqtfe
nyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdi
Timeline for d5j7ef_: