| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
| Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
| Protein automated matches [191059] (16 species) not a true protein |
| Species Uncultured bacterium [TaxId:77133] [317019] (1 PDB entry) |
| Domain d5jd3f1: 5jd3 F:1-217 [317020] Other proteins in same PDB: d5jd3a2, d5jd3b2, d5jd3c2, d5jd3d2, d5jd3e2, d5jd3f2, d5jd3g2, d5jd3h2 automated match to d4jhla_ complexed with cl, peg, so4 |
PDB Entry: 5jd3 (more details), 2.3 Å
SCOPe Domain Sequences for d5jd3f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jd3f1 c.23.10.0 (F:1-217) automated matches {Uncultured bacterium [TaxId: 77133]}
myfaagsklviigdsitdagrdkgiggeglfnahgsgyvallnahlfarfperrlrlvnq
gnsgntvrdlaarwqndvfglkpdyvammigindvwrqfdlplmtdrhvcpeeyektlde
lvartaptvkgmilltpyfiepnredamrarmdvygdlmrrvaerhgcllvdvqgafdry
lqhyhpaqlawdrihpnlaghqvianaflaatgclns
Timeline for d5jd3f1: