Lineage for d1bxre4 (1bxr E:556-676)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312607Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 312608Superfamily c.30.1: PreATP-grasp domain [52440] (5 families) (S)
    preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 312609Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 312618Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 312619Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)
  8. 312681Domain d1bxre4: 1bxr E:556-676 [31702]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2

Details for d1bxre4

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxre4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxre4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1bxre4:

Click to download the PDB-style file with coordinates for d1bxre4.
(The format of our PDB-style files is described here.)

Timeline for d1bxre4: