Lineage for d5iqya2 (5iqy A:87-213)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 2000053Species Pennisetum americanum [TaxId:4543] [317016] (1 PDB entry)
  8. 2000054Domain d5iqya2: 5iqy A:87-213 [317017]
    Other proteins in same PDB: d5iqya1
    automated match to d3uvhb2
    complexed with iod

Details for d5iqya2

PDB Entry: 5iqy (more details), 2.4 Å

PDB Description: structure of apo-dehydroascorbate reductase from pennisetum glaucum phased by iodide-sad method
PDB Compounds: (A:) Dehydroascorbate reductase

SCOPe Domain Sequences for d5iqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iqya2 a.45.1.0 (A:87-213) automated matches {Pennisetum americanum [TaxId: 4543]}
tpslvtppeyasvgskifpsfvkflkskdasdgsekalldelqaldehlkahgpyisgen
vsaadlslgpklfhlqvalehfkgwkipenltsvhaytkalfsresfvktkpanqyliag
wapkvna

SCOPe Domain Coordinates for d5iqya2:

Click to download the PDB-style file with coordinates for d5iqya2.
(The format of our PDB-style files is described here.)

Timeline for d5iqya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iqya1