Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Pennisetum americanum [TaxId:4543] [317016] (1 PDB entry) |
Domain d5iqya2: 5iqy A:87-213 [317017] Other proteins in same PDB: d5iqya1 automated match to d3uvhb2 complexed with iod |
PDB Entry: 5iqy (more details), 2.4 Å
SCOPe Domain Sequences for d5iqya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iqya2 a.45.1.0 (A:87-213) automated matches {Pennisetum americanum [TaxId: 4543]} tpslvtppeyasvgskifpsfvkflkskdasdgsekalldelqaldehlkahgpyisgen vsaadlslgpklfhlqvalehfkgwkipenltsvhaytkalfsresfvktkpanqyliag wapkvna
Timeline for d5iqya2: