SCOPe 2.08: Domain d5iqya2: 5iqy A:87-213

Lineage for d5iqya2 (5iqy A:87-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Pennisetum americanum [TaxId:4543] [317016] (1 PDB entry)

8. Domain d5iqya2: 5iqy A:87-213 [317017]
   Other proteins in same PDB: d5iqya1
   automated match to d3uvhb2
   complexed with iod

Details for d5iqya2

PDB Entry: 5iqy, 2.4 Å

PDB Description: structure of apo-dehydroascorbate reductase from pennisetum glaucum phased by iodide-sad method

PDB Compounds: (A:) Dehydroascorbate reductase

SCOPe Domain Sequences for d5iqya2:

Sequence; same for both SEQRES and ATOM records:

>d5iqya2 a.45.1.0 (A:87-213) automated matches {Pennisetum americanum [TaxId: 4543]}
tpslvtppeyasvgskifpsfvkflkskdasdgsekalldelqaldehlkahgpyisgen
vsaadlslgpklfhlqvalehfkgwkipenltsvhaytkalfsresfvktkpanqyliag
wapkvna

Timeline for d5iqya2:

• d5iqya2 first appeared in SCOPe 2.06
  
• d5iqya2 appears in SCOPe 2.07