| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Pennisetum americanum [TaxId:4543] [317014] (1 PDB entry) |
| Domain d5iqya1: 5iqy A:3-86 [317015] Other proteins in same PDB: d5iqya2 automated match to d3uvhb1 complexed with iod |
PDB Entry: 5iqy (more details), 2.4 Å
SCOPe Domain Sequences for d5iqya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iqya1 c.47.1.0 (A:3-86) automated matches {Pennisetum americanum [TaxId: 4543]}
vevcvkaavgapdilgdcpfsqrvlltleekkityemklvdlsnkpewflkispegkvpv
fnsgdgkwiadsdvitqvieekfp
Timeline for d5iqya1: