Lineage for d5iqya1 (5iqy A:3-86)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880112Species Pennisetum americanum [TaxId:4543] [317014] (1 PDB entry)
  8. 2880113Domain d5iqya1: 5iqy A:3-86 [317015]
    Other proteins in same PDB: d5iqya2
    automated match to d3uvhb1
    complexed with iod

Details for d5iqya1

PDB Entry: 5iqy (more details), 2.4 Å

PDB Description: structure of apo-dehydroascorbate reductase from pennisetum glaucum phased by iodide-sad method
PDB Compounds: (A:) Dehydroascorbate reductase

SCOPe Domain Sequences for d5iqya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iqya1 c.47.1.0 (A:3-86) automated matches {Pennisetum americanum [TaxId: 4543]}
vevcvkaavgapdilgdcpfsqrvlltleekkityemklvdlsnkpewflkispegkvpv
fnsgdgkwiadsdvitqvieekfp

SCOPe Domain Coordinates for d5iqya1:

Click to download the PDB-style file with coordinates for d5iqya1.
(The format of our PDB-style files is described here.)

Timeline for d5iqya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iqya2