![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) ![]() automatically mapped to Pfam PF03454 |
![]() | Family b.85.6.0: automated matches [259258] (1 protein) not a true family |
![]() | Protein automated matches [259259] (1 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (9 PDB entries) |
![]() | Domain d5erra3: 5err A:654-736 [317013] Other proteins in same PDB: d5erra1, d5erra2 automated match to d2ftsa1 complexed with act, adp, mg, mpd, po4 |
PDB Entry: 5err (more details), 1.65 Å
SCOPe Domain Sequences for d5erra3:
Sequence, based on SEQRES records: (download)
>d5erra3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
>d5erra3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgsrlmsmrsangllmlppkte qyvelhkgevvdvmvigrl
Timeline for d5erra3: