SCOPe 2.06: Domain d5erra2: 5err A:499-653

Lineage for d5erra2 (5err A:499-653)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [259256] (7 PDB entries)

8. Domain d5erra2: 5err A:499-653 [317012]
   Other proteins in same PDB: d5erra1, d5erra3
   automated match to d2ftsa3
   complexed with act, adp, mg, mpd, po4

Details for d5erra2

PDB Entry: 5err, 1.65 Å

PDB Description: gephe in complex with mg(2+) - adp

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erra2:

Sequence; same for both SEQRES and ATOM records:

>d5erra2 c.57.1.0 (A:499-653) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

Timeline for d5erra2:

• d5erra2 is new in SCOPe 2.06-stable
  
• d5erra2 appears in SCOPe 2.07
  
• d5erra2 appears in the current release, SCOPe 2.08