Lineage for d5j7ed_ (5j7e D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210987Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2210988Protein automated matches [190492] (20 species)
    not a true protein
  7. 2211023Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries)
  8. 2211042Domain d5j7ed_: 5j7e D: [317010]
    automated match to d4hp4b_

Details for d5j7ed_

PDB Entry: 5j7e (more details), 1.9 Å

PDB Description: heag pas domain
PDB Compounds: (D:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d5j7ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7ed_ d.110.3.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnfvlgnaqivdwpivysndgfcklsgyhraevmqksstcsfmygeltdkdtiekvrqtf
enyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdi

SCOPe Domain Coordinates for d5j7ed_:

Click to download the PDB-style file with coordinates for d5j7ed_.
(The format of our PDB-style files is described here.)

Timeline for d5j7ed_: