Lineage for d5hk8f_ (5hk8 F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (108 species)
    not a true protein
  7. 2477329Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. 2477348Domain d5hk8f_: 5hk8 F: [317005]
    automated match to d3wwoa_

Details for d5hk8f_

PDB Entry: 5hk8 (more details), 2.8 Å

PDB Description: crystal strucutre of a methylesterase protein mes16 from arabidopsis
PDB Compounds: (F:) Probable pheophorbidase

SCOPe Domain Sequences for d5hk8f_:

Sequence, based on SEQRES records: (download)

>d5hk8f_ c.69.1.0 (F:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsipsphlsnih
vgeediweytygegtdkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdl
dklppnpeaekvprvyiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttl
fayllravsfl

Sequence, based on observed residues (ATOM records): (download)

>d5hk8f_ c.69.1.0 (F:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vihfvfvhgashgawcwyklttlldaagfkstsvdltgagislidsnivfdsdqynrplf
sllsdlpphhkvilvghsigggsvtealckftdkismaiylaasmvqpgsiweytygegt
dkpptgvlmkpefirhyyysqspledvtlsskllrpapmrafqdldklppnpeaekvprv
yiktakdnlfdsvrqdllvenwppsqlyvledsdhsaffsvpttlfayllravsfl

SCOPe Domain Coordinates for d5hk8f_:

Click to download the PDB-style file with coordinates for d5hk8f_.
(The format of our PDB-style files is described here.)

Timeline for d5hk8f_: