Lineage for d5iqqd_ (5iqq D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. Protein automated matches [190896] (11 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. Domain d5iqqd_: 5iqq D: [317004]
    automated match to d1d8za_
    protein/RNA complex

Details for d5iqqd_

PDB Entry: 5iqq (more details), 2.52 Å

PDB Description: crystal structure of the human rbm7 rrm domain
PDB Compounds: (D:) RNA-binding protein 7

SCOPe Domain Sequences for d5iqqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iqqd_ d.58.7.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvp
yamnllngiklygrpikiqfr

SCOPe Domain Coordinates for d5iqqd_ are not available.

Timeline for d5iqqd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5iqqa_, d5iqqb_, d5iqqc_, d5iqqe_